Home > Products > Chemicals > Inorganic Chemical Materials > Inorganic Salt

ASIC3 channels, APETx2 inhibits ASIC3 channels1

SPECIFICATION OF APETX2

Product Name: APETx2

CAT.#: O1040-V

CAS N0.: 713544-47-9

Sequence: GTACSCGNSKGIYWFYRPSCPTDRGYTGSCRYFLGTCCTPAD(Disulfide bonds between Cys4-Cys37, Cys6-Cys30 and Cys20-Cys38)

Purity: > 98%

Solubility: Soluble in water

Form/State: Lyophilized powder

Molecular weight: 4561 Da

Molecular formula: C196H280N54O61S6

Source: Synthetic peptide

Shipping and storage: Shipped at room temperature. The product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C.

Storage of solutions: Up to two weeks at 4°C or three months at -20°C.

APPLICATION OF APETX2

APETx2, a peptide toxin effector of ASIC3, is a 42-amino-acid peptide cross-linked by three disulfide bridges.

As a leader of peptide pharmaceutical companies, we are committed to breaking the key technical barriers in peptide drug R & D, building an internationally competitive one-stop preclinical R&D service platform around peptide drugs by focusing on preclinical pharmacokinetics, pharmacological efficacy, and safety evaluation research.

More information about our peptide synthetic route, contact us.