| Product Name: |
Recombinant Streptomyces viridochromogenes Phosphinothricin N-acetyltransferase
|
| Product Type : |
Recombinant Protein |
| Code : |
CSB-EP701139FOQ |
| Size : |
1mg/500ug/200ug/50ug/10ug |
| Uniprot NO. : |
Q57146 |
| Storage : |
Store at -20℃, for extended storage, conserve at -20℃ or -80℃. |
| Relevance : |
Inactivates phosphinothricin (PPT) by transfer of an acetyl group from acetyl CoA. This enzyme is an effector of phosphinothricin tripeptide (PTT or bialaphos) resistance. |
| Image : |
|
| References : |
"Cloning of a phosphinothricin N-acetyltransferase gene from Streptomyces viridochromogenes Tue494 and its expression in Streptomyces lividans and Escherichia coli." Strauch E., Wohlleben W., Puehler A. Gene 63:65-74(1988) |
| Storage Buffer : |
20mM Tris-HCl based buffer,pH8.0 |
| Alias : |
Phosphinothricin-resistance protein |
| Species : |
Streptomyces viridochromogenes |
| Purity : |
Greater than 90% as determined by SDS-PAGE. |
| Sequence : |
MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI |
| Research Area : |
Others |
| Protocol : |
Instructions
Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
|
| Source : |
E.coli |
| Gene Names : |
pat |
| Expression Region : |
1-183aa |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Product Info : |
His-SUMO-tag |
| Mol. Weight : |
36.61kD |
| Protein Description : |
Full length |
