Recombinant Homo sapiens (Human) Chymase

Product Description

Product Name:	Recombinant Homo sapiens (Human) Chymase
Product Type :	Recombinant Protein
Code :	CSB-EP005599HU
Size :	1mg/500ug/200ug/50ug/10ug
Uniprot NO. :	P23946
Storage :	Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance :	Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.
References :	"Cloning of the gene and cDNA for human heart chymase." Urata H., Kinoshita A., Perez D.M., Misono K.S., Bumpus F.M., Graham R.M., Husain A. J. Biol. Chem. 266:17173-17179(1991)
Storage Buffer :	20mM Tris-HCl based buffer,pH8.0
Alias :	Alpha-chymase Mast cell protease I
Species :	Homo sapiens (Human)
Purity :	Greater than 90% as determined by SDS-PAGE.
Sequence :	IIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Research Area :	Cardiovascular
Source :	E.coli
Gene Names :	CMA1
Expression Region :	22-247aa
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :	His-tag
Mol. Weight :	29.11kD
Protein Description :	Full length of Chymase