Recombinant Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinos

Product Description

Product Name:	Recombinant Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum) Cellobiose dehydrogenase
Product Type :	Recombinant Protein
Code :	CSB-EP312474EUK
Size :	1mg/500ug/200ug/50ug/10ug
Uniprot NO. :	Q01738
Storage :	Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Relevance :	Degrades both lignin and cellulose. Oxidizes cellobiose to cellobionolactone.
Image :	CSB-EP312474EUK
References :	"Cloning of a cDNA encoding cellobiose dehydrogenase, a hemoflavoenzyme from Phanerochaete chrysosporium." Li B., Nagalla S.R., Renganathan V. Appl. Environ. Microbiol. 62:1329-1335(1996)
Storage Buffer :	20mM Tris-HCl based buffer,pH8.0
Alias :	Cellobiose-quinone oxidoreductase
Species :	Phanerochaete chrysosporium (White-rot fungus) (Sporotrichum pruinosum)
Purity :	Greater than 90% as determined by SDS-PAGE.
Sequence :	QSASQFTDPTTGFQFTGITDPVHDVTYGFVFPPLATSGAQSTEFIGEVVAPIASKWIGIALGGAMNNDLLLVAWANGNQIVSSTRWATGYVQPTAYTGTATLTTLPETTINSTHWKWVFRCQGCTEWNNGGGIDVTSQGVLAWAFSNVAVDDPSDPQSTFSEHTDFGFFGIDYSTAHSANYQNYLNGDSG
Research Area :	Signal Transduction
Protocol :	Instructions Protocol may be improved. Please feel free to contact CUSABIO product specialist to obtain the latest version.
Source :	E.coli
Gene Names :	CDH-1
Expression Region :	19-208aa
Notes :	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :	His-SUMO-tag
Mol. Weight :	36.33kD
Protein Description :	Full length of Heme domain